Asiaflix - Asian Dramas, Kdramas, Cdramas, Thai & Japanese dramas, movies and shows | Watch Free Streaming Online with Subtitles
Note: We will try to play from the best ad-free servers (Primary servers) automatically. If it doesn't work, kindly switch to other servers.

Work Later, Drink Now Episode 5

Subtitled

|

2021

|

South Korea

|

12 Episodes

comedydramafriendshiplifesismanceworkplace
Description: An So Hee, Han Ji Yeon, and Kang Ji Gu enjoy meeting after work and drinking together. The three women are single and in their 30's. Their jobs have An So Hee work as a broadcasting writer, Han Ji Yeon as a yoga instructor, and Kang Ji-Gu as a YouTuber. Meanwhile, Kang Buk Gu works as a PD of TV variety show. He hangs out with the 3 women. Adapted from the webtoon "Sooldo Girl" (술꾼도시처녀들) by Mi Kkang (미깡).

More

Watch the latest shows of Jeong Eun Ji with English subtitles for free in Asiaflix

Jeong Eun Ji

Watch the latest shows of Choi Shi Won with English subtitles for free in Asiaflix

Choi Shi Won

Watch the latest shows of Lee Seon Bin with English subtitles for free in Asiaflix

Lee Seon Bin

Watch the latest shows of Park Yeong Kyoo with English subtitles for free in Asiaflix

Park Yeong Kyoo

Watch the latest shows of Kim Ji Seok with English subtitles for free in Asiaflix

Kim Ji Seok

Watch the latest shows of Kim Hee Jeong with English subtitles for free in Asiaflix

Kim Hee Jeong

Watch the latest shows of Jeong Seok Yong with English subtitles for free in Asiaflix

Jeong Seok Yong

Watch the latest shows of Han Seon Hwa with English subtitles for free in Asiaflix

Han Seon Hwa

Watch the latest shows of Kwon Byeong Kil with English subtitles for free in Asiaflix

Kwon Byeong Kil

Watch the latest shows of Goo Hye Ryeong with English subtitles for free in Asiaflix

Goo Hye Ryeong

Watch the latest shows of Kim Jae Hwa with English subtitles for free in Asiaflix

Kim Jae Hwa

Watch the latest shows of Moon Hee Gyeong with English subtitles for free in Asiaflix

Moon Hee Gyeong

Watch the latest shows of Park Sang Myeon with English subtitles for free in Asiaflix

Park Sang Myeon

Watch the latest shows of Woo Hyeon with English subtitles for free in Asiaflix

Woo Hyeon

Watch the latest shows of Yoon Bok In with English subtitles for free in Asiaflix

Yoon Bok In

Watch the latest shows of Yoon Seo Hyeon with English subtitles for free in Asiaflix

Yoon Seo Hyeon

Watch the latest shows of Jeong Eun Pyo with English subtitles for free in Asiaflix

Jeong Eun Pyo

Watch the latest shows of Ok Joo Ri with English subtitles for free in Asiaflix

Ok Joo Ri

Watch the latest shows of Lee Soo Min with English subtitles for free in Asiaflix

Lee Soo Min

Watch the latest shows of Son Dong Hwa with English subtitles for free in Asiaflix

Son Dong Hwa

Watch the latest shows of Kwon Hong Seok with English subtitles for free in Asiaflix

Kwon Hong Seok

Watch the latest shows of Kim Joo Ah with English subtitles for free in Asiaflix

Kim Joo Ah

Watch the latest shows of Jo Jeong Chi with English subtitles for free in Asiaflix

Jo Jeong Chi

Watch the latest shows of Jeon Eun Mi with English subtitles for free in Asiaflix

Jeon Eun Mi

Watch the latest shows of Han Jae Seok with English subtitles for free in Asiaflix

Han Jae Seok

Watch the latest shows of Kim Jeong Min with English subtitles for free in Asiaflix

Kim Jeong Min

Watch the latest shows of Hong Jin Ki with English subtitles for free in Asiaflix

Hong Jin Ki

Watch the latest shows of Ji Seong Geun with English subtitles for free in Asiaflix

Ji Seong Geun

Watch the latest shows of Kim Jong Ho with English subtitles for free in Asiaflix

Kim Jong Ho

Watch the latest shows of Kim Nam Jin with English subtitles for free in Asiaflix

Kim Nam Jin

Watch the latest shows of Eom Tae Yoon with English subtitles for free in Asiaflix

Eom Tae Yoon

Watch the latest shows of Kim Sa Hoon with English subtitles for free in Asiaflix

Kim Sa Hoon

Watch the latest shows of Han Ji Hyo with English subtitles for free in Asiaflix

Han Ji Hyo

Watch the latest shows of Park Jeong Eon with English subtitles for free in Asiaflix

Park Jeong Eon

Watch the latest shows of Han Bom with English subtitles for free in Asiaflix

Han Bom

Watch the latest shows of Park Boo Keon with English subtitles for free in Asiaflix

Park Boo Keon

Watch the latest shows of Bin Chan Wook with English subtitles for free in Asiaflix

Bin Chan Wook

Watch the latest shows of Kim Jin Goo with English subtitles for free in Asiaflix

Kim Jin Goo

Watch the latest shows of Shin Hyeon Seung with English subtitles for free in Asiaflix

Shin Hyeon Seung

Watch the latest shows of Kim Shin Rok with English subtitles for free in Asiaflix

Kim Shin Rok

Watch the latest shows of Jeong Nan Hee with English subtitles for free in Asiaflix

Jeong Nan Hee

Watch the latest shows of Lee So Geum with English subtitles for free in Asiaflix

Lee So Geum

Watch the latest shows of Oh Il Yeong with English subtitles for free in Asiaflix

Oh Il Yeong

Watch the latest shows of Kim Seong Yong with English subtitles for free in Asiaflix

Kim Seong Yong

Watch the latest shows of Jeon Se Yong with English subtitles for free in Asiaflix

Jeon Se Yong

Watch the latest shows of Yoo Ji Yeon with English subtitles for free in Asiaflix

Yoo Ji Yeon

Watch the latest shows of Baek Hyo Won with English subtitles for free in Asiaflix

Baek Hyo Won

Watch the latest shows of Song Jae Rim with English subtitles for free in Asiaflix

Song Jae Rim

Watch the latest shows of Lee Hyeon Jin with English subtitles for free in Asiaflix

Lee Hyeon Jin

Watch the latest shows of Song Yeong Jae with English subtitles for free in Asiaflix

Song Yeong Jae

Watch the latest shows of Min Choong Seok with English subtitles for free in Asiaflix

Min Choong Seok

Watch the latest shows of Park Ji Won with English subtitles for free in Asiaflix

Park Ji Won

Watch the latest shows of Han Sang Cheol with English subtitles for free in Asiaflix

Han Sang Cheol

Watch the latest shows of Jeong Ki Seon with English subtitles for free in Asiaflix

Jeong Ki Seon

Watch the latest shows of Ko Dong Ha with English subtitles for free in Asiaflix

Ko Dong Ha

Watch the latest shows of Yoon Da Kyeong with English subtitles for free in Asiaflix

Yoon Da Kyeong

Watch the latest shows of Kim Yeong Goo with English subtitles for free in Asiaflix

Kim Yeong Goo

Watch the latest shows of Lee Teuk with English subtitles for free in Asiaflix

Lee Teuk

Watch the latest shows of Yoon Shi Yoon with English subtitles for free in Asiaflix

Yoon Shi Yoon

Watch the latest shows of Choi Yo Woon with English subtitles for free in Asiaflix

Choi Yo Woon

Watch the latest shows of Kim Yo Han with English subtitles for free in Asiaflix

Kim Yo Han

Watch the latest shows of Kong Joon Min with English subtitles for free in Asiaflix

Kong Joon Min

Watch the latest shows of Park Kyeong Ok with English subtitles for free in Asiaflix

Park Kyeong Ok

Watch the latest shows of Baek So Hyeon with English subtitles for free in Asiaflix

Baek So Hyeon

Watch the latest shows of Kim Ki Beom with English subtitles for free in Asiaflix

Kim Ki Beom

Watch the latest shows of Kim Hyeon Ji with English subtitles for free in Asiaflix

Kim Hyeon Ji

Watch the latest shows of Jeong Se Hyeon with English subtitles for free in Asiaflix

Jeong Se Hyeon

Watch the latest shows of Joo Shi Hyeon with English subtitles for free in Asiaflix

Joo Shi Hyeon

Watch the latest shows of Shim So Yeong with English subtitles for free in Asiaflix

Shim So Yeong

Watch the latest shows of Seol Jong Hwan with English subtitles for free in Asiaflix

Seol Jong Hwan

Episodes 1 - 12

1

SUB

2

SUB

3

SUB

4

SUB

5

SUB

6

SUB

7

SUB

8

SUB

9

SUB

10

SUB

11

SUB

12

SUB
There is some issue with our comments system. We are working to bring it back very soon.

Follow our social media pages Discord, Telegram, X, Reddit for more updates. Bookmark our domain now.